Details for Lyrate rockcress Locus 16034191

Position : sca3 ( 5`- 6970130 .. 6968726 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897963 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034191

Protein [Map View]
MEGNREMGPKLLDLIPQGRKWYQEDKNNTDQEKKLELRLGPPGGDEEDHSAIKKKNTETRNIKKETEDKSFHCFNGNHFS
SSNKTTYVPHISHKRTAPGPVVGWPPVRSFRKNLASTSSSKLGNESSLHGGQINKSDDGEKQVEPKKEGMFVKINMDGVP
IGRKVDLNAYNSYEQLSFAVDKLFRGLLAAQRDTSGGEGEEKPIIGLLDGKGEFTLTYEDNEGDKMLVGDVPWQMFVSSV
KRLRVIKSSEISSALTFGWSKQEKMKH*

DNA
ATGGAGGGTAACAGAGAAATGGGTCCAAAACTTCTTGATTTGATTCCCCAAGGACGAAAATGGTACCAAGAAGACAAGAA
CAACACAGATCAGGAGAAGAAACTTGAGCTAAGGCTTGGACCACCAGGTGGTGATGAAGAAGATCATTCAGCGATCAAGA
AGAAGAACACAGAGACAAGAAACATCAAGAAGGAAACAGAAGACAAATCTTTCCACTGTTTCAATGGCAATCACTTCTCT
TCTTCCAACAAAACCACTTATGTTCCTCACATCTCACATAAAAGAACTGCTCCTGGTCCAGTGGTGGGTTGGCCTCCGGT
TCGTTCGTTCAGAAAGAATCTAGCGAGCACAAGCTCTTCAAAGCTAGGTAACGAATCCTCCTTACATGGAGGTCAAATCA
ATAAGAGTGATGATGGTGAAAAGCAAGTCGAACCTAAGAAAGAAGGAATGTTTGTCAAGATCAATATGGATGGTGTTCCT
ATTGGTCGTAAAGTTGATCTCAATGCTTATAACAGCTATGAACAGCTCTCTTTCGCCGTTGACAAACTCTTCAGAGGACT
ACTCGCAGCTCAGAGAGATACCTCTGGTGGTGAAGGAGAAGAGAAACCTATAATTGGATTGTTAGATGGGAAAGGAGAAT
TTACTTTAACCTATGAAGACAATGAAGGGGACAAGATGCTTGTCGGGGATGTTCCATGGCAAATGTTCGTTTCATCGGTG
AAGAGACTGCGTGTGATTAAAAGCTCTGAGATTTCATCTGCCTTGACATTTGGATGGAGTAAGCAAGAGAAGATGAAGCA
TTGA