Details for Lyrate rockcress Locus 16034182

Position : sca5 ( 5`- 17853815 .. 17852482 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034182

Protein [Map View]
MRILAARIANHFCRARNAYQPRSRNFSSLNKKDDLTLEEEAERKIGWCLKIFFAGTATYIGYQFFPYLGDNLIHQSISLL
HVKDPLFKRMGASRLSRFAIDDERRMKVVEMGGAQELLLMLGSAKDDKTRKEALKALAALSKSGQSYEAANFLGSNGALS
IVKSTPDSLEDSDISTYKSNILEKLHEKNLAVSSN*

DNA
ATGCGGATTCTTGCTGCTCGCATAGCTAACCATTTTTGCAGGGCACGAAACGCGTATCAGCCTCGATCTCGAAATTTCTC
CTCGTTGAACAAGAAAGATGACCTTACATTGGAGGAAGAAGCTGAGAGGAAAATAGGCTGGTGTCTCAAAATTTTCTTTG
CTGGGACTGCAACGTATATCGGATACCAGTTTTTCCCGTACTTAGGTGATAACTTGATTCATCAATCAATATCGCTTTTA
CATGTCAAGGATCCTTTGTTTAAGAGAATGGGAGCTTCTAGGCTTTCCCGTTTCGCTATTGATGATGAAAGGAGGATGAA
GGTTGTGGAGATGGGTGGGGCTCAAGAGCTTCTACTTATGCTGGGAAGTGCTAAAGATGACAAGACAAGGAAAGAAGCTC
TAAAGGCTCTTGCTGCTCTCTCTAAATCAGGCCAGTCTTATGAAGCTGCCAACTTCCTAGGCTCTAATGGAGCACTCTCT
ATCGTCAAATCGACTCCAGATTCCTTGGAAGATTCAGACATTTCAACATACAAGTCAAACATACTCGAGAAGCTACATGA
GAAAAACCTCGCCGTCTCCTCCAACTGA