Details for Lyrate rockcress Locus 16034164

Position : sca3 ( 5`- 5145454 .. 5147725 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034164

Protein [Map View]
MAMYLLYESSSGYGLFEVHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPSQSALDALNQINAVSEGYMSDELRSFLE
LNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEFVHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKV
KFNVNRVDNMVIQAIFLLDTLDKDINSFAMRVREWYSWHFPELVKIVNDNNLYARVSKIIVDKSKLSEEHVPMLTEILGD
EDKAREVVEAGKASMGQDLSPVDLINVQSFAQRVMDLADYRKKLYDYLVTKMSDIAPNLASLIGEMVGARLISHAGSLTN
LAKCPSSTLQILGAEKALFRALKTRGNTPKYGLVFHSSFISRASAKNKGRIARFLANKCSIASRIDCFSDSSTTAFGEKL
REQVEERLDFYDKGVAPRKNVDVMKEVMENLEKKDEGEKTVDASEKKKKRKTEEKEEEKEEEKSKKKKKKSKAVDGEELT
TENGHSKKKKKKTKSQDDE*

DNA
ATGGCGATGTATCTTCTTTACGAATCATCCTCCGGCTACGGATTGTTCGAGGTACACGGTCTCGATGAGATTGGACAGAA
CACAGAGGCGGTTCGGAGCTCCGTCTCGGACCTTAGTCGGTTCGGGCGTGTCGTCCAGCTCACTGCTTTTCACCCATCTC
AGTCTGCACTCGACGCTCTTAACCAAATCAACGCCGTCTCTGAAGGATACATGAGTGATGAGCTGAGGAGTTTTCTGGAG
TTGAATCTCCCGAAAGTGAAGGAAGGCAAGAAGCCCAAGTTTAGTTTGGGAGTGTCTGAGCCTAAAATCGGGTCTTGCAT
TTTTGAAGCTACAAAAATTCCTTGCCAGAGTAATGAATTTGTCCATGAGCTTCTTAGAGGTGTGCGCCAGCATTTCGATA
GGTTCATCAAAGACCTAAAGCCTGGTGATTTGGAAAAAGCGCAACTTGGACTAGCTCATAGTTACAGCAGAGCAAAGGTG
AAGTTCAATGTTAACCGTGTGGATAACATGGTTATTCAAGCTATTTTCCTACTTGACACACTTGATAAGGATATCAATTC
CTTTGCTATGAGAGTCAGAGAATGGTACTCGTGGCACTTCCCTGAACTTGTCAAGATAGTCAATGACAACAACCTTTATG
CCCGAGTTTCAAAGATTATCGTGGACAAGTCGAAGTTGTCTGAAGAGCACGTCCCTATGCTTACTGAAATCCTGGGTGAT
GAAGATAAAGCAAGAGAGGTTGTTGAAGCTGGAAAAGCATCTATGGGCCAGGATTTATCACCGGTTGATCTGATCAATGT
CCAGAGTTTTGCTCAGAGAGTTATGGACCTTGCCGATTACAGGAAGAAGCTCTATGATTACCTTGTTACTAAAATGAGTG
ACATTGCTCCAAATTTGGCGTCCTTGATCGGAGAGATGGTTGGGGCTAGGTTGATTTCACATGCAGGAAGTTTGACAAAT
CTTGCCAAGTGCCCATCTTCAACTCTCCAGATTCTTGGTGCTGAGAAGGCACTTTTCAGGGCGCTGAAAACCCGTGGAAA
CACACCCAAATATGGTCTAGTATTCCATTCGTCATTCATTAGCCGTGCATCTGCTAAAAACAAGGGCCGTATTGCTCGTT
TCCTTGCAAACAAGTGCTCCATAGCTTCCCGGATCGATTGTTTCTCTGATAGCAGCACTACAGCTTTCGGTGAGAAACTA
AGGGAACAAGTGGAGGAAAGACTTGACTTTTATGACAAAGGTGTTGCCCCACGTAAGAATGTTGACGTAATGAAAGAAGT
GATGGAAAATCTTGAGAAGAAAGACGAGGGAGAAAAAACAGTGGACGCCTCAGAGAAGAAAAAGAAGAGAAAGACAGAGG
AGAAGGAGGAGGAGAAGGAAGAGGAGAAATCAAAGAAAAAGAAAAAGAAAAGCAAAGCAGTAGATGGAGAAGAATTGACA
ACAGAGAATGGTCACAGTAAGAAGAAGAAGAAGAAAACTAAGTCACAAGATGATGAATAA