Details for Lyrate rockcress Locus 16034158

Position : sca3 ( 5`- 2740651 .. 2739998 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034158

Protein [Map View]
MASLISDIEPPTTDLVRRKKRSSVSSAASPSTSAASVSGESHARWRSEKQQRIYSAKLIQALQQVRLNSSAATSSSPTAQ
KRGKAVREAADRALAVSARGRTLWSRAILANRIKLKFRKQKRPKTPTKIPSMTTVVNSSNRSRTRRVSVLRLNKKNIPDV
NRKVRVLGRLVPGCGKQSVPVILEEATDYIQALEMQVRAMNSLVQLLSSYGSAPPPI*

DNA
ATGGCGTCTCTGATCTCAGATATTGAACCGCCGACGACAGATCTCGTTCGGAGGAAGAAAAGATCCTCTGTCTCCTCCGC
CGCATCACCTAGTACAAGCGCAGCTTCCGTCTCCGGTGAGAGCCACGCGCGATGGAGATCGGAGAAGCAACAACGGATCT
ACTCAGCCAAACTGATTCAGGCGCTCCAACAAGTCCGCCTCAACTCTTCCGCCGCGACATCATCATCTCCAACGGCTCAG
AAACGAGGCAAAGCCGTCCGTGAAGCCGCCGATCGAGCTCTCGCCGTTTCCGCTCGCGGAAGAACACTCTGGAGCAGAGC
GATCCTAGCTAATCGGATCAAACTGAAATTTCGTAAACAGAAACGGCCGAAAACGCCGACGAAGATTCCGTCCATGACCA
CGGTGGTGAATAGCAGCAACAGATCGAGGACACGAAGAGTGTCGGTGTTGAGATTGAATAAGAAGAATATACCGGATGTT
AACCGGAAAGTACGTGTTCTAGGCCGGTTAGTTCCCGGTTGTGGGAAACAATCCGTACCGGTGATTTTAGAAGAAGCAAC
TGATTATATTCAGGCTCTGGAGATGCAGGTCAGAGCCATGAACTCTTTAGTTCAGCTTCTCTCCTCCTACGGCTCAGCTC
CTCCACCGATTTGA