Details for Lyrate rockcress Locus 16034139

Position : sca3 ( 5`- 1961719 .. 1960382 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034139

Protein [Map View]
MNSPLSCKNLRVFSKSVACKCLVLVGIALFYRALLLSYSPRNALSNSLLFRARHMSDSSSTGGIRTDKFLEVPQIVWGLN
NQKIAFARACLTARMMNRTLLMPSLSASLFYKEVDKLRPIPFDKVFQLERFNSLCSGFVRLARFSDVRNRAQVFDLEKGS
GRRWTVERDLEHLKQSARNESIDEFEVIRVIGKNPFLWHDHWPVEDYAKVFECMVVVDEISREADKVVMKIREAGEAERA
KLKSKTEIPGPIPFVAVHMRIEIDWMIHCKKLEQRKKVSEICSCKREIMERVGNISGLKTPTVLYLAVADTLLEEKEEDS
SVLTGWRDGLIPFEKKKLGVKEEIYGKYSYLLQSAIDYEVCLRADVFVGNSFSTFSSLIVLERTQKARKLGFMSSCKDGE
NKWRSYAYNLAGESKGVPRRWMTNMTHSSLQAISYGSNSVSCSSG*

DNA
ATGAATTCTCCGTTGAGTTGCAAGAATCTGAGAGTCTTTTCAAAATCTGTTGCTTGCAAATGTCTTGTTCTTGTTGGTAT
TGCTCTGTTCTACAGAGCTCTGTTACTCTCTTACTCTCCCAGAAACGCTCTAAGCAATAGCTTATTGTTTCGAGCCCGTC
ACATGTCAGATTCCTCCTCAACTGGTGGAATTCGGACTGATAAGTTTCTCGAGGTTCCTCAGATCGTGTGGGGTCTAAAC
AATCAGAAGATAGCTTTTGCTAGAGCTTGCTTGACTGCGAGAATGATGAACAGAACGCTTCTCATGCCTAGTCTAAGTGC
TTCCTTGTTTTACAAGGAAGTCGATAAGCTTCGTCCGATTCCGTTTGATAAAGTTTTTCAGCTTGAAAGATTCAACTCTC
TCTGTTCTGGGTTTGTGCGGCTTGCTCGGTTCTCGGATGTTAGAAACAGAGCACAAGTGTTTGATCTAGAGAAAGGTAGT
GGAAGAAGATGGACGGTTGAAAGAGACTTGGAACACTTGAAACAATCCGCTCGTAACGAGTCCATCGATGAGTTTGAAGT
GATCCGTGTCATAGGGAAAAACCCGTTCTTGTGGCACGATCATTGGCCAGTTGAAGACTACGCTAAGGTCTTTGAGTGTA
TGGTGGTGGTTGATGAAATCTCAAGAGAAGCAGATAAAGTTGTGATGAAAATCAGAGAAGCAGGTGAGGCAGAAAGAGCG
AAACTCAAATCCAAAACCGAAATCCCAGGTCCGATACCTTTTGTTGCGGTTCACATGAGGATAGAGATAGATTGGATGAT
ACATTGTAAGAAACTAGAGCAACGGAAAAAGGTCTCAGAGATTTGTAGTTGTAAAAGAGAGATTATGGAGAGAGTAGGGA
ACATTTCAGGTTTAAAGACTCCAACAGTTCTTTACCTTGCAGTAGCAGATACTCTCTTAGAAGAAAAAGAAGAAGATTCA
TCGGTTTTAACGGGTTGGAGAGACGGTTTAATACCATTTGAGAAGAAGAAGCTTGGGGTTAAAGAGGAGATTTACGGGAA
GTATTCGTATTTGCTTCAATCGGCTATAGATTACGAGGTGTGTTTAAGAGCGGATGTTTTTGTTGGTAATAGCTTTTCGA
CTTTCTCTAGTCTTATTGTTCTTGAGAGGACGCAGAAAGCGAGAAAGTTAGGGTTTATGAGTTCTTGTAAAGATGGTGAA
AACAAGTGGAGATCGTATGCATATAATCTGGCTGGTGAATCAAAGGGAGTTCCAAGAAGATGGATGACGAATATGACTCA
TTCGAGCTTGCAAGCTATTAGCTATGGCTCAAATTCTGTTTCTTGTTCTAGTGGATGA