Details for Lyrate rockcress Locus 16034122

Position : sca3 ( 5`- 8108253 .. 8114746 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034122

Protein [Map View]
MDIDFNEYKLRCELHGHDDDVRGICVCSDDNIATSSRDRTIRVWSLDPSDKRKYTSSKILLGHTSFVGPLAWIPPTDEYP
EGRLVSGSMDTFVFVWNLINGENIQTLKGHQMQVTGVAIDKEDIVSSSVDQTLKRWRNGQLVESWEAHKSPVQAVIKLPS
GQLVSGSSDASLKLWKGKTSLQTLSGHTDTVRGLAVMPDLGFLSASHDGSIRLWALSGEVLLEMVGHTSLVYSVDAHSSG
LIVSGSEDRHAKIWKDGVCVQSLEHPGCVWDAKFLESGDIVTACSDGVVRVWTVRHDAIADQMEIDAYDSQISQYKLSRK
KVGGLKLDELPGLDSLTSPGTSDGQTKVVREGDNGVAYAWNMKEQRWDKIGEVVDGPDGVADRPIYEGVQYDFVFDVDIG
DGEPIRKLPYNRSDNPYDAADKWLLKENLPFAYRQQIVEFILQNSGQKDFNFNPSFRDPFTGANAYVPGQASHTAATPAK
PLYKHIPKKGVLVFDVAQYDGILKKMTEFNTTLRSDSVNNDKSLTELEVSRVGAIVNILKDTSHYHSTNFADMDIALLLK
VLQAWPPAMMFPATDIVRMLVLHPHGASLLIKHVENNNDLLLDLIKKVTEDSALPANLLTTVRVLVNLFKNSSFHYWLQT
HHSQILDAFSNCYSSPNKNLQLAYSTLLLNYAVLLTEKKDQEGQAQVLSAALQVAEEEAADVDSKFRSLVAIGSLMLEGL
VKKIAIDFDVESIAKSAKASKEGKIAEVGADIDLVIRQ*

DNA
ATGGATATCGATTTTAACGAGTACAAGCTCAGGTGCGAGCTTCATGGCCACGATGATGATGTTCGTGGGATTTGTGTCTG
TAGTGATGATAATATAGCTACTTCATCAAGAGACAGAACCATCAGGGTTTGGTCACTGGATCCATCGGATAAGCGCAAGT
ATACCTCCTCTAAAATTCTGCTGGGGCATACTAGCTTTGTTGGGCCACTTGCGTGGATTCCACCAACTGATGAATACCCT
GAAGGAAGACTCGTCTCTGGGAGTATGGATACTTTCGTGTTTGTTTGGAATCTGATCAATGGAGAGAATATTCAGACATT
GAAAGGTCATCAGATGCAAGTCACTGGTGTTGCTATTGATAAAGAGGACATAGTGTCATCTTCAGTTGATCAAACCCTCA
AACGATGGAGAAATGGTCAGCTTGTTGAATCTTGGGAGGCACACAAGTCGCCTGTCCAGGCAGTGATAAAGCTGCCATCT
GGTCAGCTCGTTTCAGGTTCAAGTGACGCCAGTCTCAAACTCTGGAAGGGAAAAACAAGTCTGCAAACTCTTTCAGGGCA
TACAGATACTGTTCGAGGGTTAGCTGTGATGCCTGATTTAGGATTTCTTTCCGCATCACATGATGGTTCAATCAGATTAT
GGGCACTAAGTGGCGAAGTTCTTCTGGAGATGGTTGGCCACACCTCCCTTGTTTATTCAGTTGACGCACATTCGTCTGGC
CTTATTGTTAGTGGCAGTGAAGATCGCCATGCCAAGATATGGAAAGATGGAGTCTGCGTTCAGAGTTTGGAACACCCAGG
CTGTGTCTGGGATGCCAAGTTTTTGGAAAGCGGAGATATTGTGACGGCATGTTCAGATGGAGTGGTTCGTGTTTGGACAG
TACGTCATGACGCGATTGCAGATCAGATGGAGATTGATGCATATGATTCGCAAATTTCTCAGTACAAGTTGAGCAGGAAA
AAGGTTGGAGGATTGAAACTTGACGAGCTGCCGGGGCTTGATTCTCTCACGTCACCAGGTACCAGTGATGGCCAGACGAA
AGTAGTAAGGGAAGGAGACAATGGGGTTGCTTATGCATGGAATATGAAAGAACAGAGATGGGACAAAATTGGTGAGGTTG
TTGATGGCCCAGATGGTGTGGCTGATCGTCCAATTTACGAGGGAGTTCAATATGATTTTGTTTTCGATGTCGACATTGGT
GATGGGGAACCTATCCGGAAGCTGCCTTACAATCGGTCAGACAATCCTTATGATGCAGCTGACAAGTGGCTTCTCAAAGA
GAATCTCCCTTTTGCATATCGGCAGCAAATTGTTGAATTTATATTACAAAATTCTGGGCAGAAAGACTTCAACTTTAATC
CATCTTTTCGTGATCCCTTCACTGGCGCAAATGCTTATGTGCCTGGGCAAGCATCTCATACAGCTGCAACTCCGGCAAAA
CCTTTATACAAGCACATTCCAAAAAAAGGTGTGCTAGTTTTCGATGTTGCTCAATATGATGGGATTCTTAAAAAGATGAC
AGAGTTCAATACTACTTTACGATCTGACTCAGTAAACAATGACAAGTCCCTGACCGAACTCGAAGTATCCAGAGTAGGCG
CAATCGTTAATATACTCAAGGACACATCACACTACCACTCTACCAATTTTGCTGACATGGATATTGCTTTGCTTTTGAAA
GTGCTACAAGCATGGCCACCTGCAATGATGTTTCCTGCTACTGATATAGTCAGGATGCTCGTTTTGCATCCTCATGGAGC
AAGTCTACTTATCAAACATGTGGAAAACAACAATGACCTGCTTTTGGATTTGATAAAGAAAGTTACAGAAGATTCTGCTC
TTCCTGCAAATCTTTTAACGACTGTTCGTGTCCTGGTTAATCTATTCAAGAATTCTTCATTTCATTACTGGCTACAGACG
CATCATAGTCAAATTCTTGATGCCTTCTCAAACTGTTATTCATCCCCAAATAAGAATCTGCAGTTGGCTTATTCGACGTT
GCTTCTCAATTATGCAGTGCTATTAACAGAAAAGAAGGATCAAGAAGGTCAAGCTCAAGTCCTTTCAGCAGCTTTGCAGG
TTGCAGAAGAGGAGGCTGCAGATGTTGATTCCAAGTTCCGGAGTTTGGTAGCAATTGGGTCACTGATGCTTGAAGGTCTC
GTGAAGAAGATAGCGATAGATTTTGATGTAGAGAGCATTGCGAAATCAGCAAAGGCCTCAAAGGAAGGCAAGATTGCAGA
AGTTGGGGCCGATATCGATCTTGTAATTCGTCAGTAA