Details for Lyrate rockcress Locus 16034100

Position : sca3 ( 5`- 4610794 .. 4609957 -3` )
Annotation : [B2G] small nuclear ribonucleoprotein g
External links : CoGe
PGDD synteny : 16034100

Protein [Map View]
MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVEVNGDDKTDIGMVVIRGNSIVTVEALEPVGRS*

DNA
ATGAGTCGATCTGGTCAGCCTCCGGATCTCAAGAAGTACATGGACAAGAAACTCCAAATTAAGCTTAATGCCAACCGAAT
GGTTGTTGGAACTCTCCGTGGGTTTGATCAGTTCATGAATCTTGTTGTGGATAACACTGTTGAAGTCAATGGTGATGACA
AAACTGACATTGGGATGGTGGTTATAAGAGGTAACAGCATTGTCACCGTTGAAGCTCTCGAACCAGTTGGAAGATCTTAG