Details for Lyrate rockcress Locus 16034071

Position : sca3 ( 5`- 6163879 .. 6162490 -3` )
Annotation : [B2G] nodulin 3 family protein
External links : CoGe
PGDD synteny : 16034071

Protein [Map View]
MDVFAFNASLSMCKDVAGIAGNIFAFGLFVSPMPTFRRIMRNKSTEQFSGLPYIYALLNCLICLWYGTPFVSHSNTMLMT
VNSVGATFQLCYIILFILHTDKKNKMKMLGLLFVVFAVVGVIVAGSLQIPDQLTRWYFVGFLSCGTLVSMFASPLFVINL
VIRTKSVEFMPFYLSLSTFLMSASFLLYGLFNSDAFVYTPNGIGTILGIVQLALYCYYHRNSIAEETKEPLIVSYV*

DNA
ATGGATGTTTTTGCTTTCAATGCTTCTTTATCCATGTGTAAAGATGTTGCCGGAATCGCAGGCAACATATTTGCATTTGG
GCTCTTCGTTTCACCAATGCCAACGTTTAGAAGGATCATGAGGAACAAATCCACGGAGCAATTCTCCGGTTTACCATACA
TTTACGCTCTCTTAAACTGCTTGATCTGCCTTTGGTATGGAACACCTTTCGTATCACACAGCAATACCATGCTTATGACT
GTGAATTCTGTTGGAGCCACTTTTCAGCTTTGCTACATTATCCTATTCATCTTGCATACAGACAAGAAGAACAAGATGAA
GATGCTTGGTTTGCTTTTTGTGGTGTTTGCTGTGGTTGGAGTGATTGTAGCTGGAAGTCTGCAGATACCTGACCAGCTCA
CACGATGGTACTTTGTCGGGTTCTTGAGCTGCGGTACTCTTGTCTCAATGTTTGCCTCGCCTTTGTTTGTTATCAACCTA
GTGATTCGGACTAAGAGCGTTGAGTTTATGCCGTTTTATCTCTCGCTATCGACTTTCTTGATGAGCGCTTCCTTCCTTCT
TTACGGGTTATTCAATAGCGACGCCTTTGTTTATACACCAAATGGAATAGGAACGATTCTTGGTATTGTGCAGCTGGCTT
TGTACTGTTACTACCACAGGAATTCTATAGCAGAAGAAACAAAAGAACCTTTGATTGTTTCTTATGTGTGA