Details for Lyrate rockcress Locus 16034065

Position : sca3 ( 5`- 7609030 .. 7611670 -3` )
Annotation : [B2G] dnaj heat shock family protein
External links : CoGe
PGDD synteny : 16034065

Protein [Map View]
MAAMARCALIPSINPAHSFRHQFPQTNASFFLAPTLPNFLRVRRCGISGGYRRRVIIMAAGKDHYSTLNVNRNATLQEIK
SSYRKLARKYHPDMNKNPGAEDKFKQISAAYEVLSDEEKRSVYDRFGEAGLERDFNGSQDTSPGVDPFDLYSAFFGGSDG
FFGEMGESGGMGFDFMNKRSLDLDIRCDLRLSFEEAVFGVKREIEVSYLETCDGCGGTGAKSSNAIKQCSSCDGKGRVMN
SQRTPFGIMSQVSTCSKCGGEGKIITDKCRKCIGNGRLRSRKKMDVVVPPGVSDRATMRIQGEGNVDKRSGRAGDLFIVL
QVDEKRGIRREGLNLYSNINIDFTDAILGVTTKVETVEGTMDLRIPPGTQPGDTVKLPRKGVPDTDRPSIRGDHCFVVKV
SIPKKLSERERKLVEEFSSLRRSSSSTGPNETRQEEHSFGSEPRKEPPSLWHKMKNFIRPEDSRTKFGTMSLNPSLPLRG
MKVSETSIVISVLALCVITSAVALVQKKGNRSKQKKET*

DNA
ATGGCTGCAATGGCTCGCTGTGCTTTGATTCCATCTATAAACCCAGCTCATAGCTTCCGTCATCAGTTTCCGCAAACTAA
TGCGTCATTCTTCTTGGCTCCTACTCTACCGAATTTTTTGCGTGTTCGGAGATGTGGAATTTCCGGCGGATATCGCCGCC
GTGTGATCATCATGGCCGCCGGAAAGGATCACTATTCCACTTTGAATGTGAACCGCAACGCCACCTTGCAGGAGATCAAG
AGCTCGTATAGAAAACTCGCACGCAAGTATCACCCAGATATGAACAAGAACCCTGGTGCAGAAGATAAGTTCAAACAGAT
TAGTGCTGCTTACGAGGTGTTATCTGATGAGGAGAAGAGATCTGTGTATGATCGATTCGGCGAGGCAGGTTTAGAAAGAG
ATTTTAATGGATCACAGGATACTTCACCAGGGGTGGATCCATTTGACTTGTACAGTGCATTCTTTGGAGGTTCTGATGGA
TTCTTTGGGGAAATGGGTGAATCAGGAGGGATGGGTTTTGATTTCATGAATAAAAGAAGCCTTGACCTTGACATTCGGTG
TGACCTGCGGTTGAGCTTCGAAGAGGCGGTTTTTGGAGTAAAACGGGAGATTGAGGTTTCTTATTTAGAAACATGTGATG
GTTGTGGAGGAACAGGTGCCAAATCCAGTAACGCCATTAAACAGTGTAGTAGTTGTGATGGTAAAGGACGTGTGATGAAC
TCTCAGAGAACACCCTTTGGAATCATGTCTCAGGTGTCCACTTGCTCCAAATGTGGTGGTGAAGGCAAAATCATCACTGA
TAAGTGTCGAAAGTGCATTGGCAACGGGAGACTACGGTCCAGGAAAAAAATGGATGTTGTTGTCCCTCCTGGTGTCAGCG
ATAGAGCCACAATGAGAATTCAAGGAGAAGGTAACGTAGACAAGAGAAGTGGAAGAGCCGGGGACTTGTTCATCGTACTT
CAAGTTGATGAGAAGCGTGGAATTCGGCGGGAAGGGCTTAATTTATACTCCAATATCAACATAGATTTCACAGATGCTAT
ACTTGGGGTGACCACAAAGGTAGAAACTGTTGAGGGAACAATGGATCTTCGAATTCCGCCAGGAACTCAGCCTGGCGACA
CCGTGAAATTACCTAGGAAAGGAGTTCCAGACACAGATAGACCTTCAATCCGGGGAGACCATTGCTTCGTAGTGAAGGTT
TCGATCCCCAAAAAACTGAGCGAGAGGGAGCGCAAGTTGGTAGAGGAATTCTCGTCGCTCAGAAGATCTAGTAGTAGTAC
TGGACCTAATGAAACTCGTCAAGAGGAGCATAGTTTTGGCTCAGAGCCCAGAAAAGAACCACCGTCTTTGTGGCATAAAA
TGAAGAATTTCATAAGACCAGAAGATTCAAGAACGAAATTTGGGACTATGAGCTTGAACCCATCACTACCACTACGAGGA
ATGAAAGTGTCAGAGACTTCAATTGTTATCTCAGTCTTGGCTCTGTGTGTTATAACCTCGGCTGTTGCATTGGTTCAGAA
GAAGGGTAATCGCTCGAAACAAAAGAAAGAAACTTAA