Details for Lyrate rockcress Locus 16034062

Position : sca3 ( 5`- 7395001 .. 7388391 -3` )
Annotation : [B2G] protein transporter
External links : CoGe
PGDD synteny : 16034062

Protein [Map View]
MFVGDDDSVQIVRLLDQTLTSIDGVAVREATEALDRLSTELPHFPYRLLSLASGGENSSLRVAAATYLKNFTRRRTGIEG
IISEASKDFKDQLLLALLQAEPALLKVLLELLHIVVISEYVKKNAWPELVPELRSAIENSRLISRSNSSWSTVNALMVLL
TVVKPFQYFLQPKLAKEPVPQQLESITKEILVPLVSVLHRLIDKALTTHGWDELELEKTLHIICKCLYFSVKSHMPSALS
PLLDSFCRDMIRILDSLSFDWSVTPSDGYLIRSKAGKRSLLLFGTLVSRHRKYSDKLVPEIVNCSMKIVKHSSNISKLGC
LTERIISLAFDVISRVMEIGPGWRLLSPHFSFLLDFAIFPALVLNERDISEWEEDADEFIRKNLPSELEEISGWRDDLFT
ARKSAMNLLGVLAMSKGPPVSTTNKASSAACKRKKGEKNRGNNQRCMGDLLVLPFLSKFYVPSKSNKLDASTSAAYFGVL
MAYGSLQEFIQEQNPEYVASFVRTRVLPIYSTPDCSPYLVASANWVLGELASCLPEEMNADVFSSLLKALAMPDQVEISC
YPVRFSAAGGIGSLLENEYQPPEWLPFLQIITGKIGNEEDEDSMLFQLLKSVVESGNQDIATHIPYIVSSLVSNMLKFMH
PSEDPWSQAILGGLETLAAMAQTYESSKPEADEENNQATEIWLTGQGNISKALSALLQHAWLATDVPPTSSIDHLSTMLR
FIVIACTNCNVFVELRLSELLIVWADILASWNGWEESEDLSVFDCIEEVVGINNKYGFRSFLFRDMASPPAMPVRPRSVV
ESIGSFVSKAILEYPSATRRACSCVHTLLYVPNYSSDIEGVGKSLAMVFTESAFSHFLALREKPCTLWRPLLLAISSCYI
SYSDIVEGVLEKVISGGFELWVSSLAFSYSLMCDASPSVVSEVKLYVMTVVKVIKHLLDVRHGNATDDLARKCFVSLMDA
SRRLKEVNEETDDDEDDGEPGEEETESEETDSNDEDSESDDECEETEEEFLQRYAKAAAELEESEVIEEADEEDDDHEID
LGSLNEIDPQKLVLTLMEKQHEKVIKLVPSEVISTFLNSFPVYTSLFSKCL*

DNA
ATGTTCGTCGGCGACGACGACTCAGTTCAGATTGTTCGGCTTCTTGACCAGACGCTTACTTCCATTGATGGCGTTGCAGT
CCGCGAGGCGACGGAGGCTCTGGATCGACTTTCTACGGAGCTCCCTCACTTCCCATATCGTCTTCTCTCCCTCGCTTCCG
GAGGTGAAAATTCCAGCCTGAGAGTTGCTGCTGCAACATATCTGAAGAATTTTACCAGAAGGAGGACTGGGATTGAAGGG
ATAATCTCAGAAGCCAGCAAGGACTTTAAGGATCAGCTGCTCCTAGCTTTGCTTCAGGCAGAGCCTGCACTTCTTAAAGT
TTTACTTGAACTGCTCCACATTGTTGTCATTTCAGAATATGTGAAGAAAAATGCATGGCCTGAACTTGTACCGGAGCTCC
GCTCTGCTATCGAGAACAGTAGATTAATTAGCAGATCAAACTCTAGCTGGAGTACTGTGAACGCTCTGATGGTATTGCTT
ACCGTTGTAAAGCCTTTTCAGTACTTCCTGCAACCAAAACTTGCAAAGGAGCCAGTACCACAACAGCTAGAGAGTATCAC
GAAAGAAATTCTAGTACCCTTGGTGTCAGTATTACATCGTCTCATTGACAAGGCTTTGACTACCCATGGATGGGATGAAC
TGGAATTGGAAAAGACACTCCACATTATTTGCAAATGCCTATACTTTTCAGTGAAGTCTCATATGCCATCTGCTTTGTCA
CCTCTGCTCGATTCCTTCTGTCGAGATATGATCCGAATTCTGGACTCCTTGAGTTTTGACTGGAGTGTAACTCCTTCTGA
TGGGTACTTGATAAGGTCGAAAGCTGGAAAAAGAAGTTTGCTCCTCTTTGGCACACTCGTCAGCAGACATAGAAAATACT
CTGACAAATTGGTGCCGGAGATAGTAAACTGCTCAATGAAGATTGTCAAACATAGCTCAAACATCAGTAAGCTCGGATGC
CTAACTGAGAGAATTATATCACTTGCTTTTGATGTAATTTCACGCGTCATGGAAATTGGCCCTGGATGGAGATTACTTTC
ACCCCATTTTTCCTTTTTGTTGGACTTCGCAATCTTTCCAGCCCTGGTGCTTAATGAGAGGGACATCTCTGAGTGGGAAG
AAGATGCAGATGAATTCATAAGGAAAAACCTTCCATCTGAACTAGAAGAAATTTCTGGGTGGAGGGATGACTTGTTTACA
GCGAGGAAAAGCGCTATGAACTTACTTGGTGTCCTTGCCATGTCAAAGGGACCACCAGTATCTACTACAAATAAAGCTTC
CTCAGCAGCATGTAAGCGGAAGAAAGGTGAAAAGAACAGAGGAAATAACCAAAGATGCATGGGAGATCTACTGGTGCTTC
CATTTTTGTCAAAATTTTATGTGCCTTCTAAGAGTAACAAACTGGATGCTAGTACTTCAGCAGCCTATTTCGGTGTCCTA
ATGGCATATGGTAGCCTGCAAGAGTTTATCCAAGAACAAAATCCTGAGTATGTGGCATCTTTTGTCCGTACCCGTGTGCT
ACCGATTTATTCTACACCTGATTGCTCACCTTACTTGGTTGCATCTGCAAACTGGGTACTTGGAGAGCTTGCGTCTTGCC
TACCTGAGGAAATGAATGCAGATGTTTTTTCTTCCCTGCTGAAGGCATTAGCAATGCCAGATCAGGTGGAGATTTCTTGT
TACCCAGTGCGTTTTTCAGCTGCTGGTGGAATAGGTTCACTGCTCGAAAATGAGTACCAACCACCTGAATGGTTGCCGTT
TCTTCAGATTATTACTGGTAAGATTGGTAATGAGGAAGACGAGGATAGCATGTTGTTTCAGCTTCTCAAATCTGTGGTCG
AGTCGGGAAATCAAGATATTGCCACGCATATTCCGTACATTGTCTCTTCGCTAGTTAGTAATATGTTGAAGTTTATGCAT
CCAAGTGAAGATCCATGGTCTCAGGCTATTCTAGGTGGCCTTGAGACATTAGCAGCGATGGCTCAGACTTATGAAAGCTC
TAAGCCTGAAGCGGATGAGGAGAATAATCAGGCGACTGAAATATGGCTAACTGGTCAAGGCAACATCAGCAAAGCTTTGT
CAGCACTTTTACAGCACGCATGGCTGGCAACAGATGTGCCTCCGACTTCAAGCATAGATCATTTGTCGACGATGTTGCGG
TTCATTGTGATTGCCTGCACTAATTGCAATGTATTTGTGGAGCTCAGATTAAGTGAATTACTCATAGTTTGGGCCGATAT
TCTTGCTAGTTGGAATGGTTGGGAAGAGTCGGAGGATTTATCAGTTTTTGACTGTATAGAAGAAGTTGTGGGTATAAACA
ACAAATATGGTTTTAGGAGTTTCCTTTTCAGAGATATGGCATCCCCTCCAGCCATGCCAGTCCGTCCGCGATCTGTTGTT
GAATCCATTGGTTCATTTGTCAGCAAAGCCATACTTGAGTATCCGTCGGCCACAAGGAGGGCTTGTTCTTGTGTCCACAC
ATTATTATATGTACCCAACTACTCATCTGACATCGAAGGGGTGGGGAAATCATTGGCGATGGTCTTCACTGAATCAGCCT
TTTCTCATTTTCTAGCATTGCGTGAGAAACCTTGTACATTGTGGAGGCCTCTATTACTGGCAATATCATCATGCTATATC
TCCTATTCCGATATTGTGGAAGGCGTTTTAGAGAAAGTGATATCTGGAGGTTTCGAGTTATGGGTATCTTCATTGGCTTT
TTCATACTCGCTTATGTGTGATGCCAGTCCATCAGTAGTATCGGAAGTAAAACTATATGTGATGACGGTAGTAAAGGTGA
TCAAGCATCTTTTAGATGTAAGGCACGGGAATGCAACTGATGATTTGGCAAGGAAGTGCTTTGTTTCATTGATGGATGCT
TCTCGGAGGCTAAAGGAAGTGAACGAAGAAACAGACGATGATGAAGATGATGGAGAACCTGGAGAAGAAGAGACAGAATC
TGAAGAAACTGATTCAAATGATGAGGATTCTGAGAGCGATGACGAGTGTGAAGAAACGGAGGAAGAGTTTCTACAAAGGT
ATGCCAAAGCTGCAGCAGAATTGGAGGAGAGTGAAGTAATTGAAGAGGCGGATGAAGAAGATGATGACCATGAGATTGAT
TTGGGTTCTCTGAATGAAATCGATCCGCAGAAACTGGTGTTAACATTAATGGAGAAGCAGCACGAGAAAGTAATAAAACT
CGTACCCTCTGAAGTAATCTCAACCTTTCTCAATTCTTTTCCTGTATACACAAGTCTCTTCTCTAAGTGCCTCTAA