Details for Lyrate rockcress Locus 16034060

Position : sca3 ( 5`- 10631146 .. 10631802 -3` )
Annotation : [B2G] aterf1 erf1
External links : CoGe
PGDD synteny : 16034060

Protein [Map View]
MDPSFLQSPLSSFSPEYSTGSSPESFSSSSSNNYSLPFNENDSEEMFLYGLIKQSTQRNFIESNLQDLPVKSVSSRNSEK
SYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNFSPERVQESLSEMKYTYEDGCSP
VVALKRKHSMRRRKTNKKTKDSDFDHRSVKLDNVVVFEDLGEQYLEELLGSSENSGTW*

DNA
ATGGATCCATCTTTTCTTCAGTCACCGTTATCTAGCTTCTCGCCGGAATATTCTACCGGATCTTCTCCGGAATCTTTCTC
TTCCTCTTCTTCTAATAACTACTCTCTTCCCTTCAACGAGAACGACTCCGAGGAAATGTTTCTCTACGGTCTAATCAAGC
AATCCACGCAACGAAACTTCATCGAATCGAATCTTCAAGACCTTCCGGTCAAATCCGTAAGCTCAAGAAACTCAGAGAAG
TCGTACAGAGGCGTAAGACGACGGCCATGGGGGAAATTCGCGGCGGAGATAAGAGATTCGACTCGAAACGGTATTCGGGT
TTGGCTCGGGACGTTCGAAAGCGCGGAAGAGGCGGCTCTCGCCTACGATCAAGCCGCTTTCTCGATGAGAGGTTCTTCGG
CGATTCTCAATTTTTCGCCGGAGAGAGTTCAAGAGTCGCTTTCGGAGATGAAGTATACCTACGAGGATGGTTGTTCTCCG
GTTGTGGCTTTGAAGAGGAAACACTCGATGAGACGAAGAAAGACCAATAAAAAGACGAAAGACAGTGACTTTGATCACCG
CTCCGTGAAGTTAGATAATGTTGTTGTCTTTGAGGATTTGGGAGAACAGTACCTTGAAGAGCTTTTGGGTTCGTCTGAAA
ATAGTGGGACTTGGTGA