Details for Lyrate rockcress Locus 16033891

Position : sca1 ( 5`- 7683571 .. 7684554 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_312784 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16033891

Protein [Map View]
MTGFSVSLFVSNLSNVASYLSPIFENIPSTKVVPAQIEKVVSLVSRTGRDLQRYDNSGYRQVVGCVPYRYKKQQVNGIET
QEIQVLLVSAQKGKGMLFPKGGWETDESMEEAALRETIEEAGVTGELEEKLGKWQYKSKRHSIIHDGYMFALLVSQEFER
WPEAEMRQRRWVSLDEAREVCQNWWMREALEAFINLKCLADDDESGN*

DNA
ATGACAGGCTTCTCTGTGTCTCTTTTCGTCTCAAACTTATCAAATGTGGCCTCGTATTTGTCGCCCATCTTCGAGAACAT
CCCCTCCACCAAGGTTGTTCCCGCACAGATCGAGAAAGTTGTCTCTTTGGTCTCTCGTACCGGTCGCGATTTGCAGCGTT
ACGATAACTCTGGCTATCGTCAAGTCGTCGGATGTGTACCGTACAGATACAAGAAACAACAAGTCAATGGAATTGAAACG
CAAGAAATCCAAGTTCTTCTTGTCAGTGCTCAAAAGGGCAAAGGAATGTTATTTCCAAAAGGAGGTTGGGAGACGGATGA
ATCAATGGAGGAAGCTGCTTTGAGAGAGACAATCGAAGAAGCGGGTGTAACGGGAGAGCTCGAAGAAAAGCTTGGGAAAT
GGCAATACAAAAGCAAAAGGCATAGCATAATTCACGATGGATACATGTTTGCTTTGCTTGTTAGTCAAGAGTTCGAGCGA
TGGCCTGAGGCGGAAATGAGACAACGCAGATGGGTAAGTTTGGACGAAGCAAGAGAAGTATGTCAGAATTGGTGGATGAG
AGAAGCTCTTGAAGCATTCATTAACCTGAAATGTCTCGCTGACGATGATGAAAGCGGGAACTGA