Details for Lyrate rockcress Locus 16033890

Position : sca3 ( 5`- 7718186 .. 7721272 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16033890

Protein [Map View]
MELSETYACVPSTERGRGILISGDSKSDTILYTNGRSVVTLDLNNPLKVSIYGEHAYPATVARYSPNGEWIASGDVSGTV
RIWGAYNDHVLKKEFKVLAGRIDDLQWSADGMRIVASGDGKGKSLVRAFMWDSGSNVGEFDGHSRRVLSCAIKPTRPFRI
VTCGEDFLVNFYEGPPFKFKLSSREHSNFVNCVRFAPDGSKFITVSSDKKGIIYDGKTCEILGELSSDDGHKGSIYAVSW
SPDGQQVLTVSADKSAKVWDISDNGSGTLKTTLNCPGSSGGVDDMLVGCLWQNDHIVTVSLGGTISIFSASELDKSPFQF
SGHMKNVSSLAVLKGAADYILSGSYDGLICKWMLGRGFCGKLHRTQNSQIKCFAAHEEEIVTSGYDNKISRISYKDDQCT
NEESVDIGNQPKDLSLAPLSPDLLLVTFESGVVFLRDGKVVSTIDLGFTVTALAVTPDGTEAIIGGQDGKLHLYSVNGDS
LTEEAVLEKHRGAISVIRYSPDLSMFASGDLNREAVVWDRVSREMKLKNMLYHSARINCLAWSPNSTMVATGSLDTCVIV
YEVDKPAASRMTIKGAHLGGVYGLGFADDSHVVSSGEDACIRVWSLTPQ*

DNA
ATGGAGCTTTCCGAAACCTATGCTTGCGTTCCATCGACGGAGAGAGGTAGAGGAATCCTGATCTCCGGTGACTCGAAGTC
CGACACCATCCTCTACACTAATGGTCGATCCGTCGTGACTCTCGACCTCAACAATCCTTTAAAGGTCTCTATCTATGGTG
AACACGCTTACCCAGCTACGGTGGCGCGATATTCTCCTAACGGAGAGTGGATCGCGTCGGGTGATGTGTCGGGGACTGTT
AGAATCTGGGGTGCTTATAACGATCATGTGTTGAAGAAAGAGTTTAAGGTCTTGGCTGGTCGGATCGATGATCTTCAGTG
GTCGGCTGATGGGATGAGAATCGTTGCTTCTGGTGATGGCAAAGGGAAATCTCTTGTTCGTGCTTTCATGTGGGATTCAG
GATCAAATGTGGGAGAGTTTGATGGACATTCTAGGCGAGTTCTTAGCTGTGCTATCAAGCCAACTAGACCGTTCCGTATT
GTAACTTGTGGGGAAGATTTTCTGGTGAATTTCTACGAAGGTCCTCCTTTTAAGTTCAAGCTCTCAAGCAGAGAGCATTC
CAACTTTGTCAACTGTGTGAGGTTTGCACCAGATGGAAGTAAGTTCATTACTGTGAGTTCAGATAAAAAGGGAATCATAT
ATGATGGAAAGACTTGTGAGATACTGGGAGAACTCTCTTCTGATGATGGGCATAAAGGTAGCATCTATGCAGTTAGCTGG
AGTCCTGATGGTCAACAGGTGCTCACTGTTTCTGCCGACAAGTCAGCCAAAGTATGGGATATATCGGACAACGGTAGCGG
AACATTGAAGACTACATTGAATTGTCCTGGATCATCAGGTGGAGTGGACGATATGCTTGTTGGGTGTCTGTGGCAGAATG
ATCATATTGTCACTGTTTCTCTAGGTGGTACAATCAGCATATTCTCAGCAAGCGAACTTGATAAATCCCCCTTTCAGTTT
TCGGGGCACATGAAGAACGTCTCTTCCTTAGCTGTGCTTAAAGGAGCCGCTGACTACATATTATCCGGTAGTTATGATGG
ACTGATATGTAAATGGATGCTAGGCCGTGGTTTTTGCGGAAAATTGCACCGGACACAAAACTCTCAAATAAAGTGCTTTG
CTGCTCATGAAGAAGAGATCGTGACCTCTGGATATGACAATAAGATATCCAGGATTTCCTATAAAGACGATCAATGCACA
AACGAAGAGTCTGTCGACATTGGAAACCAACCAAAGGATCTAAGCCTTGCACCACTCTCACCCGATCTCCTTCTGGTGAC
ATTTGAGTCAGGAGTTGTGTTTCTCCGTGATGGGAAAGTAGTGTCAACCATCGACCTTGGATTCACTGTCACTGCTTTGG
CAGTAACACCTGATGGAACCGAAGCCATCATCGGTGGCCAAGACGGTAAACTCCATCTGTATTCTGTTAATGGTGACTCC
CTCACCGAGGAAGCAGTTCTCGAGAAACACAGAGGCGCTATCAGTGTTATACGTTATTCTCCGGATCTCTCTATGTTTGC
ATCAGGTGATTTGAACAGAGAAGCAGTTGTGTGGGACAGAGTCTCCAGAGAGATGAAACTCAAGAACATGTTGTACCATA
GTGCCCGCATAAACTGCTTAGCTTGGTCTCCAAACAGCACTATGGTTGCTACAGGATCCTTAGACACCTGTGTGATTGTG
TATGAAGTGGACAAACCTGCTGCCTCACGCATGACAATAAAAGGAGCTCACTTAGGTGGAGTTTATGGTCTGGGTTTTGC
TGATGATTCCCATGTAGTGAGTTCTGGTGAAGATGCTTGTATCCGCGTCTGGAGCTTAACTCCGCAATAA