Details for Lyrate rockcress Locus 16033862

Position : sca3 ( 5`- 10693084 .. 10695232 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16033862

Protein [Map View]
MSSSKALIKTLIKNPTRIKSKSQAKQLHAQFIRTQSLSHTSASIVISIYTNLKLLHEALLVFKTLESPPVLAWKSVIRCF
TDQSLFSRALASFVEMRASGRCPDHNVFPSVLKSCTMMMDLRFGESVHGFIVRLGMDCDLYTGNALMNMYSKLLGIDSVR
KVFELMPRKDVVSYNTVIAGYAQSGMYEDALRMVREMGTSDLKPDAFTLSSVLPIFSEYVDVLKGKEIHGYVIRKGIDSD
VYIGSSLVDMYAKSARIEDSERVFSHLYRRDSISWNSLVAGYVQNGRYNEALRLFRQMVSAKVRPGAVAFSSVIPACAHL
ATLHLGKQLHGYVLRGGFGRNIFIASALVDMYSKCGNIQAARKIFDRMNLHDEVSWTAIIMGHALHGHGHEAVSLFEEMK
RQGVKPNQVAFVAVLTACSHVGLVDEAWGYFNSMTKVYGLNQELEHYAAVADLLGRAGKLEEAYDFISKMRVEPTGSVWS
TLLSSCSVHKNLELAEKVAEKIFTIDSENMGAYVLMCNMYASNGRWKEMAKLRLRVRKKGLRKKPACSWIEMKNKTHGFV
SGDRSHPSMDRINEFLKAVMEQMEKEGYVADTSGVLHDVDEEHKRELLFGHSERLAVAFGIINTEPGTTIRVTKNIRICT
DCHVAIKFISKITEREIIVRDNSRFHHFNRGSCSCGDYW*

DNA
ATGAGTTCATCAAAAGCCCTAATCAAAACCCTGATTAAGAACCCTACTCGCATCAAATCCAAATCTCAAGCTAAGCAGCT
TCACGCGCAATTCATCAGAACTCAATCACTCTCTCACACATCTGCTTCAATCGTAATCTCAATCTACACAAACCTTAAAC
TTTTGCACGAAGCTTTGCTTGTTTTCAAAACCCTCGAGTCTCCTCCTGTTCTCGCATGGAAGTCAGTAATCAGATGCTTC
ACCGACCAGTCTTTATTCTCCCGTGCTTTGGCTTCGTTCGTGGAAATGCGAGCTTCTGGGAGATGCCCAGATCACAATGT
GTTTCCTTCTGTGCTGAAATCGTGTACGATGATGATGGATTTGAGATTTGGTGAGTCTGTTCATGGGTTTATTGTTAGGC
TTGGTATGGATTGTGATTTGTATACTGGTAATGCGCTTATGAATATGTATTCTAAGCTTCTTGGAATAGATAGTGTGAGG
AAAGTTTTTGAATTGATGCCTAGAAAGGATGTTGTGTCGTATAATACTGTCATTGCAGGGTATGCACAGAGTGGAATGTA
TGAAGATGCTTTGAGAATGGTTAGGGAGATGGGAACTAGTGATTTAAAGCCTGATGCTTTCACTTTGTCTAGTGTGCTTC
CGATATTTTCTGAGTATGTGGATGTTCTTAAGGGAAAAGAGATTCATGGGTATGTGATTAGGAAAGGGATTGATAGTGAT
GTATATATTGGGAGTAGTTTGGTTGATATGTATGCTAAAAGTGCTCGGATTGAAGACTCGGAAAGAGTGTTTTCTCACTT
GTATCGTCGGGATAGTATCTCGTGGAACTCGCTTGTAGCTGGGTATGTACAGAACGGTAGATACAATGAGGCTCTGAGAT
TATTTAGGCAAATGGTGAGCGCAAAGGTTAGGCCAGGAGCTGTGGCGTTCTCAAGTGTGATTCCTGCTTGTGCTCACCTA
GCTACCTTGCACCTTGGGAAACAACTTCACGGATATGTATTAAGAGGTGGCTTTGGGAGAAATATATTCATAGCTAGTGC
ACTTGTCGATATGTACTCAAAGTGTGGAAATATTCAGGCTGCTAGGAAGATTTTTGACAGGATGAATCTACACGACGAAG
TATCATGGACGGCTATTATAATGGGTCATGCGTTACATGGTCATGGGCATGAAGCAGTTTCGTTGTTTGAGGAGATGAAA
CGGCAAGGAGTGAAACCGAATCAAGTGGCCTTTGTTGCTGTACTAACTGCTTGTAGTCATGTGGGGTTGGTTGATGAGGC
GTGGGGATATTTCAACAGCATGACTAAGGTTTATGGTTTAAACCAGGAGTTAGAACATTACGCAGCTGTAGCGGATCTTC
TAGGCCGTGCAGGGAAATTGGAAGAAGCATACGATTTCATTTCAAAGATGCGTGTTGAACCGACGGGTAGTGTCTGGTCT
ACCTTATTGTCTTCTTGCAGCGTTCACAAGAATCTTGAGCTAGCCGAGAAGGTAGCAGAGAAGATATTCACAATTGATTC
TGAAAACATGGGAGCTTATGTTTTGATGTGCAATATGTATGCGTCTAATGGGAGATGGAAAGAAATGGCGAAACTGAGAT
TAAGAGTGAGGAAAAAAGGATTACGTAAAAAGCCAGCTTGTAGTTGGATCGAAATGAAAAACAAGACTCATGGGTTTGTT
TCAGGAGATAGATCGCATCCGAGTATGGACAGAATCAACGAGTTTCTTAAAGCTGTAATGGAACAGATGGAGAAAGAAGG
TTATGTTGCAGACACAAGCGGCGTGCTTCACGATGTAGACGAAGAGCATAAGAGAGAGCTTTTGTTTGGACACAGCGAGA
GATTGGCTGTTGCATTTGGTATCATCAACACAGAACCTGGCACAACGATTAGAGTCACTAAGAACATAAGGATTTGCACG
GATTGTCATGTCGCGATCAAGTTTATCTCGAAGATCACGGAGAGAGAGATTATTGTAAGGGATAATAGCAGATTCCACCA
TTTTAACCGTGGAAGCTGTTCTTGTGGAGACTATTGGTAA