Details for Lyrate rockcress Locus 16033860

Position : sca3 ( 5`- 2113504 .. 2114794 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16033860

Protein [Map View]
MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAV
LVGTVTDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHS
HSKPYVRGKGRKFEKARGRRKSRGFKV*

DNA
ATGGGTATTGATCTGATCGCCGGAGGTAAGAGCAAGAAGACCAAAAGGACAGCTCCAAAGTCTGATGATGTCTACCTCAA
GCTTACTGTCAAGCTTTACCGGTTTCTGGTAAGGAGAACTCAGAGCAAGTTCAATGCTGTGATATTGAAGAGGCTTTTCA
TGAGCAAAGTCAACAAAGCTCCTCTTTCTCTATCTAGGCTTGTGGAGTTCATGACTGGCAAGGAAGATAAGATTGCTGTC
TTGGTTGGAACTGTTACTGATGATTTGAGGGTACACGAGATTCCAGCAATGAAAGTGACTGCCCTGAGATTCACAGAGAG
AGCAAGGGCTCGCATTGAGAAAGCTGGAGGTGAATGCTTAACCTTTGACCAGCTCGCTCTCAGAGCTCCATTGGGCCAGA
ACACGGTTCTTCTTAGAGGACCTAAGAATTCACGTGAAGCAGTGAAGCATTTCGGACCTGCTCCTGGTGTGCCACACAGT
CACTCCAAGCCATATGTGCGGGGCAAGGGAAGGAAGTTCGAGAAGGCCAGAGGAAGGAGGAAGAGTCGGGGATTCAAGGT
TTAA