Details for Lyrate rockcress Locus 16033848

Position : sca2 ( 5`- 16457097 .. 16455987 -3` )
Annotation : [B2G] myb family transcription factor
External links : CoGe
PGDD synteny : 16033848

Protein [Map View]
MADGSTSSSESTNACSGGGTRREIMLFGVRVVLDPMRKCVSLNNLSEYEQTAETPKIDGEDRDGQDMNKTPAGYASADEA
LPISSSNVNRERKRGVPWTEEEHKLFLLGLQRVGKGDWKGISRNFVKSRTSTQVASHAQKYFIRRSNLNRRRRRSSLFDM
TTDTVNLQSEDDQVLMQENTSQLSSPVPEINNFSIHPVMQVFPEFPVPTGNQSYGQLTSSNLIKLVPLTFQSSPAPLSLN
LSLASSNLNEPSPSMHSA

DNA
ATGGCCGACGGTAGTACTAGTTCGTCGGAGTCCACCAACGCCTGCTCCGGAGGCGGCACGAGAAGAGAGATTATGCTGTT
CGGCGTCAGGGTTGTGCTTGACCCGATGAGAAAGTGCGTGAGTTTGAACAATTTGTCCGAGTATGAGCAGACGGCGGAGA
CTCCAAAGATCGACGGCGAGGATAGAGATGGACAAGATATGAACAAAACCCCCGCCGGTTACGCCTCGGCGGATGAAGCT
CTTCCGATTTCTTCTTCTAACGTGAACCGCGAGAGAAAACGAGGAGTTCCATGGACTGAAGAAGAACACAAGCTGTTCTT
GCTTGGGCTGCAGAGAGTAGGTAAAGGAGATTGGAAAGGAATATCCAGAAACTTTGTCAAGAGCAGGACTTCTACACAAG
TTGCTAGTCATGCTCAGAAATACTTCATCCGGCGAAGCAATCTTAACCGTCGCCGCCGAAGATCTAGCCTTTTTGACATG
ACTACTGATACGGTAAATCTCCAATCGGAAGATGATCAGGTACTTATGCAGGAGAACACATCACAATTATCTTCTCCTGT
ACCTGAAATCAACAACTTCTCTATACATCCGGTTATGCAAGTCTTTCCCGAGTTCCCGGTACCTACAGGGAATCAATCAT
ACGGACAGCTGACTTCCTCGAATCTCATCAAGTTGGTTCCATTAACCTTTCAGTCAAGTCCTGCACCGCTCTCTCTCAAC
CTGTCGCTAGCTTCATCTAATCTTAATGAACCATCTCCTTCAATGCATTCAGCATT