Details for Lyrate rockcress Locus 16033838

Position : sca2 ( 5`- 16471960 .. 16471048 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476624 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16033838

Protein [Map View]
MAFSATLSQLSSLSTISSSLPLLSRRFPHRSLPQFTVKAEVEKEKQSTQAKSEGEASPAATKTPKTLPKKPVYSMKKGQI
VRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLRVFETGEYALVGWVGIPTAPAWLPTDMLIKSEKLVYERM*

DNA
ATGGCTTTCTCAGCGACTCTGTCTCAGCTTTCTTCTCTTTCTACCATCTCCTCTTCATTACCACTTCTTTCTAGAAGATT
TCCTCATCGATCTCTTCCTCAGTTCACAGTCAAAGCAGAGGTAGAGAAAGAGAAACAGAGCACGCAGGCCAAATCTGAAG
GGGAAGCATCACCAGCTGCAACCAAAACCCCTAAAACTCTTCCCAAGAAACCGGTTTACTCGATGAAGAAGGGTCAAATC
GTTCGTGTGGACAAAGAGAAGTATCTCAACAGCATCAATTACTTATCAGTTGGACATCCTCCTTTCTACAAAGGACTTGA
TTACATTTACGAAGATCGCGGCGAGGTCTTGGACCTTCGTGTCTTTGAGACAGGAGAGTATGCACTTGTTGGATGGGTTG
GTATCCCCACCGCACCGGCTTGGCTTCCAACTGATATGCTCATCAAGAGTGAGAAACTTGTTTATGAACGAATGTAG