Details for Lyrate rockcress Locus 16033834

Position : sca3 ( 5`- 4345846 .. 4348020 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317880 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16033834

Protein [Map View]
MKPSVSLDNWRDYFRRGDSDIFGIIDHAIMVAAADWPNEFKSRRDRIAELLFSCRVSRCIGCDHLELSIAGDEEANHGCR
TVETVGGGGDRDDSGVATDDGEEASVIVDEVMRNRDILLNKEDETESVLLESLRKLESMSMSVDILKDTEIGKAVNGLRR
HSSDKISKLAKTLFAEWKKLVDQWMNTPEEMAGTEGTPESANLSVIDEEEAFPSPPHDLDIYAPEPNGFELSQRKCYPDK
FLLLSLFQNVFGHLKILDCLDCDGNPRHSVESKHERKMQSSERSRPEGTNEANVVGGYSKDQHIRREDRPMKHSATDFDE
PRRQLKQSREQMVPAIQRKPPIVAKQKRKLAGPQQDKLKALDPDAKFEFAKRKLQESYQQHENAKRQRTIQVLETIPKQN
KVQKPQLKRPTRR*

DNA
ATGAAACCATCGGTTTCGTTGGATAATTGGAGGGACTATTTCCGGCGAGGAGATTCTGATATTTTTGGTATCATTGATCA
TGCAATTATGGTAGCTGCTGCAGATTGGCCAAATGAGTTTAAATCCAGGAGAGATAGAATTGCTGAGCTTCTATTCTCTT
GTAGAGTGAGTCGCTGCATTGGTTGTGACCACCTTGAGCTGTCGATTGCTGGAGACGAAGAGGCTAACCATGGCTGTAGG
ACGGTGGAGACAGTTGGCGGCGGCGGTGATAGGGATGATTCTGGTGTTGCGACGGATGATGGCGAAGAGGCTTCTGTGAT
TGTTGATGAGGTTATGAGGAACAGAGATATCTTGTTGAACAAAGAAGATGAGACAGAATCTGTGTTACTCGAATCCCTGA
GAAAGCTTGAGTCAATGTCTATGAGTGTAGACATTCTTAAGGATACTGAAATCGGAAAGGCTGTTAATGGTTTGAGGAGA
CATAGTTCCGATAAGATTAGCAAACTTGCAAAGACTCTTTTCGCAGAGTGGAAGAAGTTGGTGGACCAGTGGATGAACAC
CCCGGAGGAAATGGCTGGCACTGAAGGTACGCCAGAGTCAGCAAACCTTTCAGTAATTGATGAAGAAGAAGCCTTTCCTT
CTCCTCCACATGATTTAGATATCTATGCACCTGAACCCAATGGATTTGAACTCTCTCAGAGGAAATGTTATCCTGACAAG
TTTCTTCTCTTGTCCCTGTTTCAAAATGTCTTTGGTCACTTAAAGATCTTAGATTGCTTGGACTGCGATGGAAATCCTCG
TCACAGTGTGGAGTCAAAACATGAAAGAAAAATGCAAAGTAGCGAGAGGAGTAGACCTGAGGGTACAAATGAAGCCAATG
TGGTTGGGGGGTACAGCAAGGATCAACACATTAGGAGAGAAGATAGACCTATGAAGCACTCAGCCACCGATTTTGATGAG
CCTAGAAGACAACTAAAGCAAAGTAGAGAACAAATGGTACCCGCAATCCAAAGAAAACCGCCTATTGTTGCTAAGCAAAA
GCGGAAACTTGCTGGACCTCAACAAGATAAACTCAAAGCTCTGGATCCAGACGCAAAGTTTGAGTTTGCAAAGCGGAAAC
TCCAAGAGAGCTACCAACAACATGAGAATGCCAAGAGACAGAGGACGATACAAGTACTGGAAACTATCCCAAAGCAAAAT
AAAGTTCAGAAACCGCAACTCAAGAGACCCACACGAAGATAG