Details for Lyrate rockcress Locus 16033827

Position : sca3 ( 5`- 10832933 .. 10830741 -3` )
Annotation : [B2G] dienelactone hydrolase family protein
External links : CoGe
PGDD synteny : 16033827

Protein [Map View]
MSGHQCTENPPHLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRKLADKVAEAGFYAVVPDFFYGDP
YNPENKDRPLLTWAKDHGQEKGFEDSKPIVEALKNKGITSIGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKD
VNIPIAVLGAELDQVSPPELVRQFEDILASKPEVKSFVKIFPRVKHGWTVRYNENDPSEVEAAEEAHMDMLAWLIDYVK*

DNA
ATGTCGGGTCATCAGTGCACCGAGAACCCGCCTCATCTGGATCCAAATAGCGGGTCAGGTCATGTCGAGAAACTCGGCAA
CCTTGACACCTACGTCTCTGGTTCCACTCATTCAAAGCTTGCTGTTCTTCTTGTCTCTCATGTTTTCGGATATGAAACTC
CTAACCTGAGGAAACTTGCTGACAAGGTTGCAGAAGCTGGATTCTATGCGGTGGTTCCCGATTTCTTCTATGGAGATCCT
TATAATCCCGAGAATAAGGATCGACCGCTTCTTACATGGGCAAAAGATCATGGACAAGAGAAAGGGTTTGAGGACTCAAA
GCCAATAGTGGAGGCCTTGAAGAACAAAGGCATAACTAGTATAGGAGCAGCAGGGTTCTGTTGGGGTGCAAAAGTTGCAG
TGGAACTAGCTAAGCAAAAGCTTGTTGACGCTACTGTTTTGTTACATCCTTCTCGTGTTACGGTGGATGATATCAAAGAT
GTCAACATTCCAATCGCGGTATTAGGAGCTGAACTCGATCAAGTGTCCCCTCCAGAACTTGTGAGGCAATTCGAAGATAT
TTTAGCTTCTAAACCTGAGGTGAAGAGTTTTGTGAAGATATTCCCAAGAGTCAAACACGGTTGGACTGTTAGATATAATG
AAAATGATCCATCAGAAGTTGAAGCTGCAGAGGAAGCTCACATGGACATGCTCGCTTGGCTCATCGACTATGTCAAGTGA