Details for Lyrate rockcress Locus 16033815

Position : sca3 ( 5`- 12211613 .. 12212944 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16033815

Protein [Map View]
MEIFQWLFKLGRSEPSSINCTDHEPTTTLTKCTDHRTRRSSTRGSKHKNQRSYRGIWLWCRKDVAKACFSSTLTLRRLNS
FRRGHLLGSMAKIKAQGGEEQVTSTRFDLKKAIKVFKPEKQDETNKEKSKSEHSKGKATLLRMKELIKWAAAAKSDKAVK
FFTPKIMMELRNRRKLKMMREVNEEESTKRMSSVSANISLRWESSESCTTISSSDHISIVSSPAILVSLSPTPLHRCRSR
KYNWITTDSEFVVLEL*

DNA
ATGGAGATCTTTCAATGGCTCTTCAAGTTAGGGAGATCAGAGCCCAGTTCAATCAATTGTACTGATCATGAACCCACCAC
AACTCTAACAAAGTGCACAGATCACAGAACAAGAAGATCATCTACAAGAGGGTCTAAACATAAAAACCAGAGGAGTTATA
GAGGAATCTGGCTATGGTGTAGAAAAGACGTAGCCAAGGCTTGTTTCTCTAGCACACTGACTTTAAGAAGACTTAATAGC
TTTAGGAGAGGACATTTACTTGGCTCCATGGCAAAGATAAAAGCACAAGGAGGAGAAGAGCAAGTGACATCGACAAGGTT
TGATCTGAAAAAGGCTATAAAAGTCTTCAAACCGGAGAAACAAGACGAAACCAATAAAGAGAAGTCGAAAAGCGAGCATA
GCAAAGGTAAGGCCACACTTTTAAGAATGAAGGAGCTCATCAAATGGGCTGCAGCAGCCAAATCCGACAAAGCTGTCAAA
TTCTTTACCCCTAAGATAATGATGGAGTTGAGAAACCGAAGAAAGTTGAAGATGATGAGAGAGGTGAATGAAGAAGAATC
AACAAAAAGGATGAGTAGTGTATCTGCAAATATAAGTTTGAGATGGGAGAGTAGTGAGAGTTGCACAACAATCTCTTCCT
CTGATCACATCTCTATAGTTTCTTCACCAGCAATCCTTGTTTCCTTGAGTCCTACGCCACTCCACCGATGTAGATCCAGG
AAATACAACTGGATCACTACTGATTCTGAATTTGTGGTGTTAGAGTTATGA