Details for Lyrate rockcress Locus 16033804

Position : sca3 ( 5`- 2811531 .. 2804355 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16033804

Protein [Map View]
MGAPEKSQSNTNSMQRVKVYHLNEDGKWDDRGTGHVSIDFVERSEELSLCVIDEEDNETLLVHPINPEDIYRKQEDTIIS
WRDPERSTELALSFQETAGCSYVWDQICTMQRNLHFSSLNSETFHSLNSELRELPAVELTTLPLILKIVTESGITDQMRL
TELILKDHDFFRNLMGVFKICEDLENVDGLHMIFNIVKGIILLNSSQILEKIFGDELIMEIIGCLEYDPGVPHSQHHRNF
LKEHVVFKEAIPIKDPLVLSKIHQTYRIGYLKDVVLARVLDDAIVANLNSVIHANNAIVVSLLKDDSTFIQELFARLRSP
STSVESKKNLVYFLHEFCSLSKSLQVVQQLRLFRDLINEGIFHVIEEVLQIPDKKLVLTGTDILILFLTQDPNLLRSYVV
RTEGNPLLGLLVKGMMEDFGDKMHCQFLEIIRTLLDANALSGGAQRANIMDIFYEKHLPELVDVITASCPEKSGNTSEGA
ARRIFTKPEVLLNICELLCFCIMQDASRTKCSFLQNNVTEKVLHLTRRKEKYLVVAAIRFVRTLLSVHDDYVQNYIVKNN
MLKPIIDVFIANGNRYNLLNSAVLDLLEHIRKGNATLLLKYIVDTFWDQLAPFQCLTSIQAFKVKYEQCLESAGPKSTAD
AVDPRRRIDERALEKEEEDYFNEDSDEEDSASASNTQKEKPASNIQKEQPKPHLSNGVAASPTSSSPRSGGLVDYEDDED
DEDYKPPPRKQPEASEDEEGELLRLKRKSPCVEREQEPSKKPRLGKSSKRENVFAVLCSTLSHAVLTGKKSPGTAGSAAR
SIVAKGAEDSRSSEETNSSSSDDENHKDGVSSSEHETSDNGKLNGEESLVVAPKSSPEMAVNGS*

DNA
ATGGGCGCCCCGGAAAAGTCGCAATCTAATACCAATTCGATGCAGAGAGTGAAAGTCTATCATTTGAATGAAGATGGTAA
ATGGGATGATCGAGGAACTGGGCACGTAAGCATCGACTTTGTGGAGCGATCTGAAGAACTCAGTCTATGCGTAATTGATG
AAGAAGATAACGAGACCTTACTTGTTCATCCCATCAACCCTGAGGACATTTATAGGAAACAAGAAGACACAATAATCTCA
TGGAGAGACCCAGAGCGCTCAACAGAATTGGCTTTAAGCTTTCAAGAGACTGCGGGGTGCTCTTATGTATGGGATCAAAT
CTGCACCATGCAACGAAATTTGCATTTCAGCTCTCTTAACAGCGAAACATTTCACAGCTTGAATAGTGAGTTGAGGGAGC
TTCCTGCTGTAGAGCTTACTACTCTTCCCCTAATACTAAAGATTGTTACAGAGAGTGGCATTACAGATCAGATGCGGCTA
ACCGAACTTATTTTGAAGGATCATGATTTCTTCCGGAATCTGATGGGTGTATTTAAAATATGCGAGGACTTGGAAAATGT
TGATGGCCTTCATATGATATTCAACATTGTCAAGGGAATCATTTTGCTTAACAGTTCTCAGATCTTGGAGAAAATATTTG
GAGATGAATTGATTATGGAGATTATCGGATGCCTTGAATATGATCCCGGTGTTCCTCACTCTCAGCATCACCGGAATTTT
CTGAAGGAGCATGTTGTTTTTAAGGAGGCTATACCAATTAAAGATCCCTTAGTCCTGTCGAAGATACACCAGACGTACAG
AATTGGTTACTTGAAGGATGTTGTTTTGGCTAGAGTACTAGATGATGCTATAGTTGCAAACTTGAATTCAGTAATCCATG
CGAACAATGCCATTGTAGTTTCATTGCTGAAGGACGATAGCACTTTTATTCAAGAGTTATTTGCAAGGTTGAGGTCGCCT
TCTACATCTGTGGAATCCAAGAAAAATTTGGTATATTTCTTGCACGAATTTTGTAGTTTAAGCAAGAGCCTCCAGGTGGT
GCAGCAGTTGCGACTTTTTAGGGACCTTATCAATGAAGGCATTTTTCATGTCATAGAAGAAGTCTTGCAGATTCCAGACA
AAAAACTCGTATTGACTGGGACAGATATCCTGATTCTTTTCTTGACTCAAGACCCCAACCTTTTACGTTCTTATGTTGTT
CGGACAGAAGGAAACCCCCTCCTCGGTCTCCTGGTCAAGGGAATGATGGAAGACTTTGGTGATAAGATGCATTGCCAATT
TCTAGAAATTATCCGAACCTTACTTGATGCAAATGCATTGTCTGGTGGGGCTCAGAGAGCGAATATCATGGATATCTTCT
ACGAGAAGCATCTACCTGAGTTAGTGGATGTTATTACTGCCTCATGTCCTGAGAAGTCGGGCAACACATCTGAAGGTGCT
GCCAGAAGGATTTTCACAAAGCCTGAAGTCCTGTTGAACATATGTGAATTGTTGTGCTTTTGCATTATGCAAGATGCATC
CAGAACAAAATGCAGTTTTCTCCAAAACAATGTGACTGAAAAGGTTTTGCATCTCACACGGAGAAAGGAAAAATACCTAG
TGGTCGCTGCTATACGATTTGTCCGTACTCTCCTCTCTGTCCATGATGATTATGTCCAGAATTACATTGTTAAAAACAAC
ATGCTGAAACCGATCATAGATGTCTTCATTGCCAATGGAAACCGGTACAATCTGCTGAACTCTGCAGTCTTGGATCTGCT
TGAGCACATACGCAAGGGAAATGCAACTCTGTTGCTCAAATACATAGTTGATACGTTCTGGGACCAGTTGGCCCCATTTC
AGTGCTTGACTTCCATCCAGGCTTTCAAGGTTAAGTATGAACAGTGTTTAGAAAGTGCCGGACCAAAAAGCACTGCTGAT
GCGGTTGATCCAAGAAGAAGAATTGACGAGCGTGCATTGGAGAAAGAGGAGGAAGATTATTTCAATGAAGACAGCGATGA
AGAAGATTCAGCCTCTGCTTCTAATACACAAAAGGAAAAACCTGCTTCTAATATACAGAAAGAACAACCTAAGCCTCATC
TTTCCAATGGAGTGGCTGCAAGCCCTACTTCTTCAAGTCCGAGGTCTGGAGGCTTGGTTGATTATGAGGACGATGAAGAT
GATGAAGACTATAAACCTCCTCCCCGGAAACAGCCAGAAGCCTCTGAGGATGAGGAGGGCGAGCTCCTTAGACTGAAACG
CAAATCCCCTTGCGTAGAAAGAGAACAAGAGCCGTCCAAGAAACCACGGCTGGGGAAAAGTTCGAAAAGGGAAAATGTAT
TTGCTGTGCTATGTTCGACACTGAGCCATGCAGTGCTTACGGGTAAGAAAAGTCCAGGCACCGCAGGATCTGCAGCCCGG
TCAATAGTGGCCAAGGGAGCGGAGGACTCAAGAAGTAGTGAAGAGACTAATAGCAGCAGTTCAGATGATGAAAATCATAA
GGATGGAGTATCGAGTTCTGAACATGAAACATCAGACAATGGAAAGCTAAATGGGGAAGAATCTCTGGTAGTAGCTCCAA
AATCATCACCTGAAATGGCTGTAAATGGATCCTGA