Details for Lyrate rockcress Locus 16033778

Position : sca3 ( 5`- 8296422 .. 8295256 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16033778

Protein [Map View]
MPHCFTFKPPSAEASLADDPLPHSSPEGSVASTFNISLELAHAFQTPSYHDIRSRLLAVDPTQENLELFLSQELKPKNEC
VQEALSLRHAKQTTLTNLISTFFQHSEDATRFCLNLYQNVHSARCHLYTPLLDLFKIFPRDSHSAIDESFCNLAFDVFLK
LDTFENPFASPESHSFQDTQLCFYQLADKLDTRIRKSKSRVRLLHHATAGSALCLVTAVVAVAASAAFIAYHALPTLVVV
AGPLCTPYLPHSFKKEELSNISQLNVAAKGTFALNKDLDTIDRLVSRLHTGIKNDKLLIRLGLERGRDVYSVQEFVKQLR
KSHVNHTHQLEVLEDHICRWFTNVNKSRSLLLKEILRPQT*

DNA
ATGCCGCACTGTTTTACCTTCAAGCCACCTTCTGCGGAGGCCTCTCTCGCCGACGACCCTCTTCCCCATTCTTCTCCAGA
GGGTAGTGTGGCCTCCACTTTTAACATCAGCCTCGAGTTGGCTCACGCTTTTCAAACCCCTTCCTACCATGATATACGTT
CACGGCTTCTTGCGGTTGACCCAACACAAGAAAATCTCGAGCTGTTTCTCTCTCAAGAGCTCAAACCAAAGAATGAATGC
GTTCAGGAAGCTCTTAGTCTTAGACACGCCAAGCAAACTACACTTACCAATCTTATCTCCACTTTCTTCCAACACAGCGA
AGACGCTACCCGCTTTTGTTTGAATCTTTACCAAAACGTCCACAGTGCTCGCTGCCACCTCTACACACCCCTCTTAGACC
TCTTCAAAATCTTTCCCCGTGATTCCCATTCCGCTATTGACGAGTCCTTCTGTAACTTAGCCTTCGATGTTTTCCTTAAG
CTTGACACGTTTGAAAACCCTTTCGCATCTCCTGAATCTCACAGCTTTCAAGACACCCAATTATGCTTTTATCAGCTGGC
TGACAAGCTGGACACCCGTATCCGTAAGTCTAAGTCACGGGTCCGCCTCCTCCATCATGCCACAGCTGGTTCTGCCTTGT
GTCTTGTTACTGCTGTTGTTGCGGTTGCTGCTTCTGCGGCTTTTATCGCCTATCATGCACTTCCGACCCTTGTTGTTGTT
GCAGGTCCCTTGTGCACTCCCTACCTCCCTCACAGTTTCAAGAAGGAGGAGTTATCTAACATTTCTCAGCTAAATGTTGC
TGCCAAGGGTACTTTTGCGCTCAACAAAGATCTTGACACCATTGACCGTCTTGTCTCCCGTTTGCACACGGGGATTAAAA
ACGACAAGCTTCTCATTCGACTTGGATTGGAGAGGGGGAGGGACGTGTATTCAGTTCAGGAGTTTGTGAAACAGCTTCGC
AAGAGCCATGTTAACCACACCCATCAACTCGAGGTTCTTGAGGATCATATTTGTCGTTGGTTCACTAACGTTAACAAATC
CAGATCGTTGCTCCTTAAAGAGATCCTTCGTCCCCAAACGTAA