Details for Lyrate rockcress Locus 16033772

Position : sca3 ( 5`- 9698845 .. 9696859 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16033772

Protein [Map View]
MAESPSPSPTEEIVRLIKRLSAYVAFKMSSLFSTSSIRNLDSRSIGAIAGLAIAVIFTWRAIRTPGEHRQRRQPKRRINN
AETSSAAAAAAQSNVASVLPEFSSPREDNAVQDVVDQFFQPVKPTLGQIVRQKLSEGRKVTCRLLGVILEETSPEELQKQ
ATVRSSVLEVLLEITKYSDLYLMERVLDDESEAKVLQALENAGVFTSGGLVKDKVLFCSTEIGRTSFVRQLEPDWHIDTN
PEISTQLARFIKYQLHVSTVKPERTAPNVFTSQSIEQFFGCV*

DNA
ATGGCGGAATCGCCGTCGCCGTCGCCTACTGAAGAGATCGTTCGGTTGATTAAGCGTTTAAGCGCTTATGTTGCTTTCAA
AATGTCAAGCCTTTTCTCTACTTCATCGATTCGCAATCTGGATTCAAGATCGATTGGTGCGATTGCGGGGCTTGCGATTG
CGGTGATTTTTACGTGGAGGGCGATAAGAACGCCGGGGGAGCATCGTCAAAGAAGGCAGCCGAAGCGTAGGATTAACAAT
GCTGAAACGTCTAGTGCTGCTGCTGCTGCTGCTCAGTCGAATGTAGCTTCGGTACTTCCTGAATTTTCTTCGCCTCGTGA
GGATAATGCGGTGCAAGATGTTGTTGATCAGTTCTTTCAACCTGTTAAACCTACCTTGGGGCAAATAGTTAGACAGAAGC
TTAGTGAAGGAAGGAAGGTAACATGCCGTCTTCTTGGAGTAATTCTTGAGGAAACAAGTCCAGAAGAACTCCAAAAACAA
GCAACAGTGAGGTCATCTGTTTTGGAAGTTCTGCTAGAGATTACAAAGTATAGTGATTTATATCTCATGGAAAGAGTTCT
TGACGATGAAAGCGAAGCCAAAGTTCTACAGGCTTTAGAGAATGCAGGAGTTTTCACATCTGGTGGTTTGGTCAAAGATA
AGGTCCTCTTTTGTAGTACAGAGATAGGAAGAACTTCCTTTGTCAGACAACTAGAACCTGACTGGCATATCGATACAAAC
CCGGAAATCAGCACACAACTAGCTAGGTTCATCAAATATCAGCTTCACGTCTCTACGGTGAAACCCGAGCGAACGGCTCC
AAATGTGTTCACCTCGCAGTCAATAGAACAGTTCTTTGGATGTGTTTGA