Details for Lyrate rockcress Locus 16033771

Position : sca3 ( 5`- 953723 .. 951439 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16033771

Protein [Map View]
MAPVSLPPGFRFHPTDEELITYYLKRKINGLEIELEVIAEVDLYKCEPWDLPGKSLLPSKDQEWYFFSPRDRKYPNGSRT
NRATKGGYWKATGKDRRVSWRDRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRLDETECEPSAYGMQDAYALCRVFKKIVI
EAKPRDQHRSYVHAMSNVIGNCSSRFDACSDLEISSTTHQVQNTFQPRFGNERFNSNAISNEDWSQYYGSSYRPFPTPYK
VNTEIECSMLQHNISLPPLRVENSSVSDCDFFKSMTHNNDNGVFDDFTFAASNSNHYNSVGDQVIHVGNYDEQQLITSNH
HMNQAGYIEDQKIISSLDNTDQDLGFHGNNTNDNIDIDDFFSFDTYNEENVNRIEDNEDVNKNETLDSSEFDVVEEETRF
NNQMLISTSQTTKILYHQVVPSHTVKVHVNPINHNVEERTLFIEEDKDSWLQRAEKITKTKLTLFSLVAQQYYKCRLAIF
F*

DNA
ATGGCTCCTGTCTCGTTACCTCCAGGTTTCAGATTCCATCCAACGGACGAGGAACTAATTACTTACTATCTAAAAAGAAA
GATCAACGGTCTAGAAATCGAACTTGAAGTTATCGCTGAAGTTGATCTTTACAAGTGTGAGCCATGGGACTTGCCAGGGA
AGTCCTTGCTTCCGAGCAAAGACCAAGAATGGTACTTCTTCAGCCCACGGGACCGGAAGTATCCCAACGGTTCAAGGACG
AACCGAGCAACCAAAGGCGGTTATTGGAAGGCTACGGGTAAAGACCGCCGAGTGAGTTGGAGAGACCGAGCCATTGGAAC
CAAGAAGACATTGGTTTACTACCGTGGGCGCGCACCACACGGCATAAGAACTGGTTGGGTCATGCACGAATATCGACTTG
ATGAAACAGAATGTGAGCCTTCTGCTTACGGCATGCAGGACGCATATGCACTTTGTCGTGTGTTCAAAAAGATTGTTATT
GAAGCTAAGCCAAGAGATCAGCACCGGTCATATGTACACGCGATGTCCAATGTGATTGGTAATTGCTCATCGCGTTTTGA
CGCTTGTTCGGATCTCGAAATCAGTTCAACTACTCATCAAGTTCAAAACACATTCCAACCGCGATTTGGCAACGAGCGTT
TTAACTCTAACGCAATCAGCAACGAGGACTGGTCACAATACTACGGTTCTTCTTATAGACCGTTCCCTACTCCATATAAG
GTTAATACAGAGATCGAATGTTCAATGTTACAACACAATATATCTCTACCACCGTTGCGTGTAGAGAACTCTTCGGTTAG
TGATTGCGATTTCTTCAAGAGTATGACTCACAACAACGATAATGGCGTTTTTGATGACTTTACTTTCGCTGCAAGTAACT
CCAACCACTATAATAGCGTTGGTGATCAAGTGATCCACGTTGGCAATTATGATGAACAACAATTAATAACGTCAAATCAT
CATATGAACCAGGCCGGTTATATAGAAGATCAGAAGATCATATCGAGTTTGGATAATACTGACCAAGATCTTGGATTTCA
TGGGAACAATACCAATGACAACATAGATATCGATGATTTTTTCTCGTTTGATACGTATAACGAGGAAAACGTAAACAGGA
TAGAAGACAATGAAGACGTAAATAAAAATGAAACCCTTGATTCATCGGAATTCGATGTGGTTGAAGAGGAAACTAGATTT
AACAACCAAATGCTCATCTCGACATCTCAAACAACGAAGATTCTATATCACCAAGTCGTACCTTCTCACACGGTTAAAGT
TCACGTCAATCCTATTAATCACAATGTGGAAGAGAGAACATTGTTCATTGAAGAGGACAAAGATTCTTGGTTACAAAGAG
CTGAGAAGATCACGAAGACTAAACTAACACTTTTTAGTTTAGTGGCTCAGCAATACTACAAATGTCGTCTTGCCATTTTT
TTCTGA