Details for Lyrate rockcress Locus 16033758

Position : sca3 ( 5`- 11717872 .. 11714269 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_342596 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16033758

Protein [Map View]
MDMTTCVARRTRSRTESYLNSILNRSKGITGEEDSLNSRTEKRRVNMRDACSPSPRKKKRRRSKVGEDDDDDDVEFIRTD
YPEGKRDDENVGSTSGNFESKSLDCSDFDVDDGNLGGEERISNFNPLSPDDDVVFVRTVLRENDHVEEDDNVGSASVISP
RVCDFDVDGADLRGEEKTSTLDHLSPDDDDDVVFVGTVPGDVEDGNVGSGVCDILLDDVNLRGEEKTYESDEVVSLSFNS
DDEECGTDSGEEVSGEDRDSSEIDMNEDANDPSYNMEESSDPSCEESSDSDFVRSEDEEGGTGDIAKGEKNPSEKVYYQK
KSRSFRRKHNLEVINLLAKSIWESKDVFKEDICSGDKMAEVDSREDGINRDSSSEKVNEQGKPREPRSFHRVREKNHLNG
ESFYGGENLCDGEETIHYSTEDSPPLNLRFGCEEPVLIEKTEEEKELDSLWEDMAVALTLEGMNSSTPAKNGDKLCSKGT
HDFVLDEEIGLKCLHCSYVAVEIKNISPAMVKYRPSVNDNKKCSDKKGDPLPNRLEFDASGPSSHDTPLEKTEGTVWRYV
PGIKDTLYPHQQEGFEFIWKNLAGTTKLNELNSVGVKGSGGCIISHKAGTGKTRLTIVFLQSYLERFPDSHPMVIAPASL
MRTWEEEFRKWNANIPFYNMNSPQFSGHEDVEAVSCLEGDRHHNSIRMVKLVSWWKQKSILGVSYPLYEKLATNKNAEGM
QVFRRMLVELPGLLVLDEGHTPRNQNSLIWKVLTEVRTEKRIILSGTLFQNNFKELSNVLCLARPACKDTISSRLHELIK
CSQEGEHGRVNEENRIVDLKAVIAPFVHVHEGDILQESLLGLRDCVLVLNPPFQQKKILDRIDTSQSTFEFEHKLSAVSV
HPSLYLCCNPTKKENLVIGPATLETLKKLRLKYKEGVKTKFLIDFIRISGTMKEKVLVYSQYIDTLKLIMEQLSLVFSWK
EGEEILFMHGKVEQRDRQHLIDNFNKPDSGSKVLLASTKACSEGISLVGASRVVILDVVWNPSVESQAISRAFRLGQKRA
VFIYHLMVKDTSEWNKYCKQSEKHRISELVFSSTNEKDKPINNEVDSEDRILDEMVRHEKLKHIFEKILYHPKESDMFTS
FF*

DNA
ATGGATATGACTACTTGTGTTGCTAGAAGAACTCGTTCAAGGACTGAATCTTACTTGAATTCGATTCTCAATAGATCAAA
GGGGATTACTGGAGAAGAGGATTCGTTAAATTCGAGGACGGAGAAGAGAAGAGTGAACATGCGTGATGCTTGTTCACCGT
CTCCGAGGAAGAAGAAACGACGGCGGAGTAAGGTGGGTGAGGATGATGACGACGACGATGTTGAATTTATCAGAACTGAT
TATCCAGAAGGTAAGCGTGATGATGAGAATGTTGGTTCTACTTCTGGGAATTTTGAATCGAAATCGCTTGATTGTTCTGA
TTTTGATGTGGATGATGGTAACTTGGGAGGTGAAGAGAGAATTTCTAATTTTAACCCTTTATCTCCGGATGATGATGTTG
TTTTTGTTAGAACTGTTTTGAGAGAGAATGATCATGTTGAAGAGGATGACAATGTGGGTTCTGCTTCGGTGATTTCTCCT
AGGGTTTGCGATTTTGATGTGGATGGTGCTGATTTGAGGGGTGAGGAGAAAACTTCTACTTTGGATCATTTATCTCCGGA
TGATGATGATGATGTTGTTTTTGTTGGAACTGTTCCGGGAGATGTTGAGGATGGCAATGTTGGTTCTGGGGTTTGTGATA
TTCTTTTGGATGATGTTAATTTGAGGGGTGAGGAGAAGACTTATGAGTCTGATGAGGTTGTGAGTCTAAGTTTTAATTCT
GATGACGAGGAATGTGGGACTGATTCAGGAGAGGAAGTTAGTGGCGAAGATAGAGATTCTAGTGAGATTGATATGAATGA
AGATGCTAATGACCCATCTTATAACATGGAGGAAAGTTCAGATCCTTCTTGTGAGGAGAGCTCTGATAGTGATTTCGTTC
GTTCTGAGGATGAAGAGGGTGGTACCGGAGACATTGCTAAAGGCGAAAAGAACCCAAGTGAAAAAGTATACTACCAAAAG
AAGTCGAGGAGTTTTCGTAGGAAGCATAACTTGGAAGTAATTAACCTGCTAGCTAAATCTATTTGGGAGAGCAAAGACGT
TTTCAAGGAAGACATTTGCTCCGGGGACAAAATGGCAGAGGTTGATTCTAGAGAAGATGGTATAAATAGGGATAGCTCAA
GTGAAAAGGTAAATGAACAGGGGAAACCAAGGGAACCGAGGAGTTTCCACAGGGTGAGGGAGAAGAACCACTTGAATGGT
GAGAGTTTTTATGGTGGCGAAAATCTATGTGATGGAGAAGAGACAATACACTACTCGACAGAAGATTCACCTCCATTAAA
CTTGAGATTTGGCTGCGAGGAGCCTGTGCTTATCGAGAAAACAGAAGAGGAGAAAGAATTAGACAGCTTGTGGGAAGATA
TGGCCGTTGCTCTAACATTGGAAGGAATGAACTCATCTACTCCTGCTAAAAATGGAGATAAGCTATGTAGCAAAGGGACG
CACGACTTTGTCCTGGATGAGGAAATCGGTTTGAAATGCCTCCACTGTTCGTATGTGGCTGTCGAGATCAAAAACATCTC
ACCAGCTATGGTCAAGTATCGTCCTAGTGTTAATGACAATAAAAAATGTAGTGATAAAAAGGGTGACCCTTTACCTAACA
GGCTTGAGTTTGATGCTTCAGGTCCCAGCAGTCATGACACCCCTTTGGAGAAGACAGAAGGAACTGTCTGGCGATACGTC
CCTGGCATCAAAGATACTTTGTACCCACACCAACAAGAAGGCTTTGAATTTATTTGGAAGAACTTAGCCGGGACAACAAA
ACTTAATGAGTTGAACAGCGTAGGGGTTAAGGGAAGTGGCGGATGCATTATTTCGCATAAGGCTGGAACTGGTAAGACGC
GCTTGACCATCGTTTTTCTTCAGTCATACTTAGAACGGTTTCCAGATAGCCATCCTATGGTCATAGCTCCTGCAAGTCTA
ATGCGTACATGGGAAGAAGAATTCAGGAAATGGAACGCAAATATTCCATTTTATAATATGAATAGTCCGCAGTTCTCAGG
GCATGAGGACGTTGAAGCTGTCTCATGTTTAGAGGGAGATAGGCATCATAATTCCATCCGTATGGTTAAGCTAGTTTCGT
GGTGGAAGCAGAAAAGCATTCTTGGAGTTAGCTACCCTCTGTATGAGAAGCTCGCAACAAATAAGAACGCTGAAGGAATG
CAAGTGTTTAGAAGGATGTTGGTAGAATTGCCGGGGTTGCTGGTCCTTGACGAGGGCCACACCCCGAGAAACCAGAATAG
TCTCATTTGGAAAGTGCTTACTGAAGTCAGAACAGAAAAGCGTATCATTCTTTCAGGGACACTGTTCCAGAATAATTTCA
AGGAACTTTCTAACGTCTTATGCCTGGCAAGACCAGCTTGTAAAGATACGATTTCGTCGAGGCTACATGAACTTATCAAG
TGCAGCCAAGAAGGAGAACACGGAAGGGTGAATGAAGAAAATAGAATTGTGGATCTTAAGGCTGTGATTGCCCCTTTTGT
GCATGTCCACGAAGGAGACATTCTTCAAGAAAGCCTTCTAGGTCTAAGAGACTGTGTTCTGGTGTTGAACCCGCCTTTTC
AACAAAAGAAAATTCTGGACAGAATTGACACTTCTCAAAGCACATTTGAATTTGAGCACAAGCTTTCAGCTGTTTCAGTA
CACCCATCTCTGTATTTGTGCTGCAATCCGACGAAAAAGGAAAACTTGGTTATTGGGCCAGCAACATTAGAAACTCTGAA
GAAGCTTAGACTTAAGTACAAGGAAGGTGTGAAAACAAAGTTCCTTATCGACTTCATCCGCATCAGTGGAACCATGAAAG
AGAAAGTGTTGGTGTATAGCCAATACATTGACACTCTAAAGCTGATCATGGAGCAGCTCAGTTTAGTATTTAGCTGGAAA
GAAGGGGAAGAAATTCTCTTTATGCATGGTAAAGTTGAACAAAGAGACAGGCAGCATCTGATCGACAACTTCAACAAACC
AGACAGTGGATCTAAAGTTCTACTGGCATCAACAAAAGCATGTTCCGAGGGTATCAGTCTTGTTGGCGCTTCAAGAGTTG
TGATTCTTGATGTTGTTTGGAACCCTTCTGTTGAAAGCCAAGCCATAAGTCGGGCTTTCAGACTTGGTCAAAAGCGTGCT
GTGTTCATTTACCATCTCATGGTGAAAGACACATCTGAGTGGAACAAGTACTGTAAGCAAAGTGAGAAACATCGCATATC
CGAACTGGTCTTCTCTTCTACCAATGAGAAGGATAAGCCGATCAACAACGAAGTTGATTCCGAAGATAGAATCCTCGACG
AGATGGTTCGACACGAGAAGCTGAAACACATCTTTGAGAAGATACTTTATCACCCAAAAGAATCTGACATGTTTACCAGC
TTCTTCTGA